Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID395140743
StrainMtb_H37Rv_broad
Protein IDAFN51902.1
Description PPE family protein [Mycobacterium tuberculosis H37Rv]
Sequence MLWHAMPPELNTARLMAGAGPAPMLAAAAGWQTLSAALDAQAVELTARLN
SLGEAWTGGGSDKALAAATPMVVWLQTASTQAKTRAMQATAQAAAYTQAM
ATTPSLPEIAANHITQAVLTATNFFGINTIPIALTEMDYFIRMWNQAALA
MEVYQAETAVNTLFEKLEPMASILDPGASQSTTNPIFGMPSPGSSTPVGQ
LPPAATQTLGQLGEMSGPMQQLTQPLQQVTSLFSQVGGTGGGNPADEEAA
QMGLLGTSPLSNHPLAGGSGPSAGAGLLRAESLPGAGGSLTRTPLMSQLI
EKPVAPSVMPAAAAGSSATGGAAPVGAGAMGQGAQSGGSTRPGLVAPAPL
AQEREEDDEDDWDEEDDW
B cell epitope (IEDB)1
T cell epitope (IEDB)94
MHC binder (IEDB)258
Vaccine TargetYes
B cell prediction (LBtope)24
MHC class II prediction (Propred)38
MHC class 1 prediction (Propred1)216
CTL epitope prediction (CTLpred)30
Prediction of interferon-gamma inducing peptides (IFNepitope)188
Prediction of IL4 inducing peptides (IL4pred)182