Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID395140753
StrainMtb_H37Rv_broad
Protein IDAFN51912.1
Description type VII secretion-associated serine protease mycosin [Mycobacterium tub
Sequence MHRIFLITVALALLTASPASAITPPPIDPGALPPDVTGPDQPTEQRVLCA
SPTTLPGSGFHDPPWSNTYLGVADAHKFATGAGVTVAVIDTGVDASPRVP
AEPGGDFVDQAGNGLSDCDAHGTLTASIIAGRPAPTDGFVGVAPDARLLS
LRQTSEAFEPVGSQANPNDPNATPAAGSIRSLARAVVHAANLGVGVINIS
EAACYKVSRPIDETSLGASIDYAVNVKGVVVVVAAGNTGGDCVQNPAPDP
STPGDPRGWNNVQTVVTPAWYAPLVLSVGGIGQTGMPSSFSMHGPWVDVA
APAENIVALGDTGEPVNALQGREGPVPIAGTSFAAAYVSGLAALLRQRFP
DLTPAQIIHRITATARHPGGGVDDLVGAGVIDAVAALTWDIPPGPASAPY
NVRRLPPPVVEPGPDRRPITAVALVAVGLTLALGLGALARRALSRR
B cell epitope (IEDB)2
T cell epitope (IEDB)10
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)60
MHC class II prediction (Propred)98
MHC class 1 prediction (Propred1)553
CTL epitope prediction (CTLpred)128
Prediction of interferon-gamma inducing peptides (IFNepitope)361
Prediction of IL4 inducing peptides (IL4pred)556