Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID41410081
StrainM_avium_K-10
Protein IDNP_962917.1
Description RegX3 [Mycobacterium avium subsp. paratuberculosis K-10]
Sequence MTSVLIVEDEESLADPLAFLLRKEGFEATVVTDGSAALAEFDRAGADIVL
LDLMLPGMSGTDVCKQLRARSSVPVIMVTARDSEIDKVVGLELGADDYVT
KPYSARELIARIRAVLRRGGDDDSEISDGVLESGPVRMDVERHVVSVNGD
TITLPLKEFDLLEYLMRNSGRVLTRGQLIDRVWGADYVGDTKTLDVHVKR
LRSKIEADPANPVHLVTVRGLGYKLEG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)21
MHC class II prediction (Propred)37
MHC class 1 prediction (Propred1)157
CTL epitope prediction (CTLpred)42
Prediction of interferon-gamma inducing peptides (IFNepitope)69
Prediction of IL4 inducing peptides (IL4pred)167