Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433625501
StrainM_canettii_CIPT_140060008
Protein IDYP_007259130.1
Description Putative serine/threonine-protein kinase PknG [Mycobacterium canett
Sequence MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPT
LGPDTEPQDRMATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVP
ESKRFCWNCGRPVGRSDSETKGASEGWCPYCGSPYSFLPQLNPGDIVAGQ
YEVKGCIAHGGLGWIYLALDRNVNGRPVVLKGLVHSGDAEAQAMAMAERQ
FLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSLKRSKGQKLPV
AEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI
NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYV
DGLPEDDPVLKTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVV
AQDTGVPRPGLSTIFSPSRSTFGVDLLVAHTDVYLDGQVHAEKLTANEIV
TALSVPLVDPTDVAASVLQATVLSQPVQTLDSLRAARHGALDADGVDFSE
SVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVWYRAVAELLTG
DYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTND
GVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSG
RSTSEVTEEQIRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKAST
NHILGFPFTSHGLRLGVEASLRSLARVAPTQRHRYTLVDMANKVRPTSTF
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)56
MHC class II prediction (Propred)105
MHC class 1 prediction (Propred1)508
CTL epitope prediction (CTLpred)127
Prediction of interferon-gamma inducing peptides (IFNepitope)299
Prediction of IL4 inducing peptides (IL4pred)424