Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433626075
StrainM_canettii_CIPT_140060008
Protein IDYP_007259704.1
Description Putative serine protease PepD (serine proteinase) (MTB32b) [Mycobac
Sequence MAKLARVVGLVQEEQPSDMTNHPRYSPPPQQPGTPGYAQGQQQTYSQQFD
WRYPPSPPPQPTQYRQPYEALGGTRPGLIPGVIPTMTPPPGMVRQRPRAG
MLAIGAVTIAVVSAGIGGAAASLVGFNRAPAGPSGGPVAASAAPSIPAAN
MPPGSVEQVAAKVVPSVVMLETDLGRQSEEGSGIILSAEGLILTNNHVIA
AAAKPPLGSPPPKTTVTFSDGRTAPFTVVGADPTSDIAVVRVQGVSGLTP
ISLGSSSDLRVGQPVLAIGSPLGLEGTVTTGIVSALNRPVSTTGEAGNQN
TVLDAIQTDAAINPGNSGGALVNMNAQLVGVNSAIATLGADSADAQSGSI
GLGFAIPVDQAKRIADELISTGKASHASLGVQVTNDKDTPGAKIVEVVAG
GAAANAGVPKGVVVTKVDDRPINSADALVAAVRSKAPGATVALTFQDPSG
GSRTVQVTLGKAEQ
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)59
MHC class II prediction (Propred)46
MHC class 1 prediction (Propred1)270
CTL epitope prediction (CTLpred)51
Prediction of interferon-gamma inducing peptides (IFNepitope)218
Prediction of IL4 inducing peptides (IL4pred)245