Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433626849
StrainM_canettii_CIPT_140060008
Protein IDYP_007260478.1
Description Phospholipase C 4 (MTP40 antigen) [Mycobacterium canettii CIPT 1400
Sequence MSQSHIGGVSRREFLAKVAAGGAGALMSFAGPVIESAYGAGPCSGHLTDI
EHFVLFMQENRSFDHYFGTLSGTDGFNTVSPLFQQKGWNPMTQALDATGV
TMPYRFDTTRGPFLDGACVNDPDHSWVAMHESWNGGVNDNWLPAQAKTRS
AAHTPTVMGYYTRQDIPIHYLLADAFTVCDRYFCSVLGPTLPNRLYWLSA
TIDPDGQNGGPELQSPTFQPVRRFGWRIMPQNLSDAGVSWKVYRNKTLGP
ISSVLTYGSLVTSFKQSADPRSDLVRFGVAPSYPASFAADVLANRLPRVS
WVIPNVLESEHPAVPAAAGAFAIVKILRILLANPAVWEKTALIVSYDENG
GFFDHVVPATAPAGTPGEYVTVPDIDQVPGSGGIRGPIGLGFRVPCFVIS
PYSRGPQMVHDTFDHTSQLRLLETRFGVPVPNLTAWRRSVTGDMTSTFNF
AVPPNSSWPKLDYPGLHALSTVPQCVPNAALGTINRGIPYRVPYPQIMPT
QETTPTRGIPSGPC
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)41
MHC class II prediction (Propred)73
MHC class 1 prediction (Propred1)338
CTL epitope prediction (CTLpred)80
Prediction of interferon-gamma inducing peptides (IFNepitope)171
Prediction of IL4 inducing peptides (IL4pred)379