Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433626891
StrainM_canettii_CIPT_140060008
Protein IDYP_007260520.1
Description ESX conserved component EccD5 [Mycobacterium canettii CIPT 14006000
Sequence MTAVADAPQADIEGVASPQAVVVGVMAGEGVQIGVLLDANAPVSVMTDPL
LKVVNSRLRELGEAPLEATGRGRWALCLVDGAPLRATQSLTEQDVYDGDR
LWIRFIADTERRSQVIEHISTAVASDLSKRFARIDPIVAVQVGASMVATG
VVLATGVLGWWRWHHNTWLTTIYTAVIGVLVLAVAMLLLMRAKTDADRRV
ADIMLMSAIMPVTVAAAAAPPGPVGSPQAVLGFGVLTVAAALALRFTGRR
LGIYTTIVIIGALTMLAALARMVAATSAVTLLSSLLLICVVAYHAAPALS
RRLAGIRLPVFPSATSRWVFEARPDLPTTVVVSGGSAPVLEGPSSVRDVL
LQAERARSFLSGLLTGLGVMVVVCMTSLCDPHTGQRWLPLILAGFTSGFL
LLRGRSYVDRWQSITLAGTAVIIAAAVCVRYALELSSPLAVSIVAAILVL
LPAAGMAAAAHVPHTIYSPLFRKFVEWIEYLCLMPIFPLALWLMNVYAAI
RYR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)16
MHC class II prediction (Propred)118
MHC class 1 prediction (Propred1)379
CTL epitope prediction (CTLpred)104
Prediction of interferon-gamma inducing peptides (IFNepitope)197
Prediction of IL4 inducing peptides (IL4pred)281