Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433628685
StrainM_canettii_CIPT_140060008
Protein IDYP_007262314.1
Description Putative FadE28-like Acyl-CoA dehydrogenase [Mycobacterium canettii
Sequence MDFDPTAEQQAVADVVTSVLERDISWEALVCGGVTALPVPERLGGDGVGL
FEVGALLTEVGRHGAVTPALATLGLGVVPLLELASAEQQDRFLAGVAKGG
VLTAALNEPGAALPDRPATSFVGGRLSGTKVGVGYAEQADWMLVTADNAV
VVVSPTADGVRMVRTPTSNGSDEYVMTMDGVAVADCDILADVAAHRVNQL
ALAVMGAYADGLVAGALRLTADYVANRKQFGKPLSTFQTVAAQLAEVYIA
SRTIDLVAKSVIWRLAEDLDAGDDLGVLGYWVTSQAPPAMQICHHLHGGM
GMDVTYPMHRYYSTIKDLTRLLGGPSHRLELLGARCSLT
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)23
MHC class II prediction (Propred)52
MHC class 1 prediction (Propred1)229
CTL epitope prediction (CTLpred)46
Prediction of interferon-gamma inducing peptides (IFNepitope)129
Prediction of IL4 inducing peptides (IL4pred)182