Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433629903
StrainM_canettii_CIPT_140070010
Protein IDYP_007263531.1
Description Putative phosphate-transport ATP-binding protein ABC transporter Ph
Sequence MAKRLDLTDVNIYYGSFHAVADVSLAILPRSVTAFIGPSGCGKTTVLRTL
NRMHEVIPGARVEGAVLLDDQDIYAPGIDPVGVRRAIGMVFQRPNPFPAM
SIRNNVVAGLKLQGVRNRKVLDDTAEYSLRGANLWDEVKDRLDKPGGGLS
GGQQQRLCIARAIAVQPDVLLMDEPCSSLDPISTMAIEDLISELKQRYTI
VIVTHNMQQAARVSDQTAFFNLEAVGKPGRLVEIASTEKIFSNPNQKATE
DYISGRFG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)13
MHC class II prediction (Propred)43
MHC class 1 prediction (Propred1)170
CTL epitope prediction (CTLpred)53
Prediction of interferon-gamma inducing peptides (IFNepitope)117
Prediction of IL4 inducing peptides (IL4pred)169