Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433629988
StrainM_canettii_CIPT_140070010
Protein IDYP_007263616.1
Description Outer membrane protein a OmpA [Mycobacterium canettii CIPT 14007001
Sequence MASKAGLGQTPATTDARRTQKFYRGSPGRPWLIGAVVIPLLIAAIGYGAF
QRPQSVTGPTGVLPTLTPTSTGGASALSLSLLSISRSGNTVTLIGDFPDE
AAKAALMTALNGLLAPGVNVIDQIHVDPVVRSLDFSSAEPVFTASVPIPD
FGLKVERDTVTLTGTAPSPEHKDAVKRAATSTWPDMKIVDNIEVTGQAPP
GPPAAGPCADLQSAINTVTGGPIAFGNDGASLIPADYEILNRVADKLKAC
PDARVTINGYTDNTGSEGINIPLSAQRAKIVADYLVARGVAGDHIATVGL
GSVNPIASNDTPEGRAKNRRVEIVVN
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)25
MHC class II prediction (Propred)39
MHC class 1 prediction (Propred1)204
CTL epitope prediction (CTLpred)41
Prediction of interferon-gamma inducing peptides (IFNepitope)111
Prediction of IL4 inducing peptides (IL4pred)211