Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433630201
StrainM_canettii_CIPT_140070010
Protein IDYP_007263829.1
Description Putative glycosyl hydrolase [Mycobacterium canettii CIPT 140070010]
Sequence MPKRPDNQTWRYWRTVTGVVVAGAVLVVGGLSGRVTRADNLSCSVIKCVA
LTFDDGPGPYTDRLLKILQDNDAKATFFLIGNKVAANPAGAQRIADAGME
IGSHTWEHPNMTTIPPEDIPAQFSRANDAITAATGRTPTLYRPAGGLSND
AVRQAAAKVGQAEILWDVIPFDWINDSNTAATRHMLMTQIKPGSVVLFHD
TYSSTVDVVYQFIPVLKANGYRLVTVSELLGPRAPGSSYGSRENGPPVNE
LRDIPASEIPPLPNTSSPKPMPNFPITDIAGQNSGGPNNGA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)2
Vaccine TargetYes
B cell prediction (LBtope)28
MHC class II prediction (Propred)39
MHC class 1 prediction (Propred1)182
CTL epitope prediction (CTLpred)38
Prediction of interferon-gamma inducing peptides (IFNepitope)99
Prediction of IL4 inducing peptides (IL4pred)201