Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433630920
StrainM_canettii_CIPT_140070010
Protein IDYP_007264548.1
Description Putative preprotein translocase ATPase SecA2 [Mycobacterium canetti
Sequence MNVHGCTRIAACRCTDTHPRGRPAFAYRWFVPKTTRAQPGRLSSRFWRLL
GASTEKNRSRSLADVTASAEYDKEAADLSDEKLRKAAGLLNLDDLAESAD
IPQFLAIAREAAERRTGLRPFDVQLLGALRMLAGDVIEMATGEGKTLAGA
IAAAGYALAGRHVHVVTINDYLARRDAEWMGPLLDAMGLTVGWITADSTA
DERRTAYDRDVTYASVNEIGFDVLRDQLVTDVDDLVSPNPDVALIDEADS
VLVDEALVPLVLAGTTHRETPRLEIIRLVAELVGDKDADEYFATDSDNRN
VHLTEHGARRVEKALGGIDLYSEEHVGTTLTEVNVALHAHVLLQRDVHYI
VRDDAVHLINASRGRIAQLQRWPDGLQAAVEAKEGIETTETGEVLDTITV
QALINRYATVCGMTGTALAAGEQLRQFYQLGVSPIPPNKPNIREDEADRV
YITAAAKNDGIVEHITEVHQRGQPVLVGTRDVAESEELHERLVRRGVPAV
VLNAKNDAEEARVIAEAGKYGAVTVSTQMAGRGTDIRLGGSDEADHDRVA
ELGGLHVVGTGRHHTERLDNQLRGRAGRQGDPGASVFFSSWEDDVVAANL
DHNKLPMATDEDGRIVSPRTGGLLDHAQRVAEGRLLDVHANTWRYNQLIA
QQRAIIVERRNTLLRTATAREELAELAPKRYEELSDKVSEERLETICRQI
MLYHLDRGWADHLAYLADIRESIHLRALGRQNPLDEFHRMAVDAFASLAA
DAIEAAQQTFETANVLDHEPGLDLSKLARPTSTWTYMVNDNPLSDDTLSA
LSLPGVFR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)76
MHC class II prediction (Propred)95
MHC class 1 prediction (Propred1)554
CTL epitope prediction (CTLpred)144
Prediction of interferon-gamma inducing peptides (IFNepitope)337
Prediction of IL4 inducing peptides (IL4pred)519