Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433632776
StrainM_canettii_CIPT_140070010
Protein IDYP_007266404.1
Description Putative bifunctional membrane-associated penicillin-binding protei
Sequence MPERLPAAITVLKLAGCCLLASVVATALTFPFAGGLGLMSNRASEVVANG
SAQLLEGQVPAVSTMVDAKGNTIAWLYSQRRFEVPSDKIANTMKLAIVSI
EDKRFADHSGVDWKGTLTGLAGYASGDLDTRGGSTLEQQYVKNYQLLVTA
QTDAEKRAAVETTPARKLREIRMALTLDKTFTKSEILTRYLNLVSFGNNS
FGVQDAAQTYFGINASDLNWQQAALLAGMVQSTSTLNPYTNPDGALARRN
VVLDTMIENLPGEAEALRAAKAEPLGVLPQPNELPRGCIAAGDRAFFCDY
VQEYLSRAGISKEQVAKGGYLIRTTLDPEVQAPVKAAIDKYASPNLAGIS
SVMSVIKPGKNAHKVLAMASNRKYGLDLEAGETMRPQPFSLVGDGAGSIF
KIFTTAAALDMGMGINAQLDVPPRFQAKGLGSGGAKGCPKETWCVVNAGN
YRGSMNVTDALATSPNTAFAKLISQVGVGRAVDMAIKLGLRSYANPGTAR
DYNPDSNESLADFVKRQNLGSFTLGPIELNALELSNVAATLASGGVWCPP
NPIDQLIDRNGNEVAVTTETCDQVVPAGLANTLANAMSKDAVGSGTAAGS
AGAAGWDLPMSGKTGTTEAHRSAGFVGFTNRYAAANYIYDDSSSPTDLCS
GPLRHCGSGDLYGGNEPSRTWFAAMKPIANNFGEVQLPPTDPRYVDGAPG
SRVPSVAGLDVDAARQRLKDAGFQVADQTNSVNSSAKYGEVVGTSPSGQT
IPGSIVTIQISNGIPPAPPPPPLPEDGGPPPPVGSQVVEIPGLPPITIPL
LAPPPPAPPP
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)68
MHC class II prediction (Propred)102
MHC class 1 prediction (Propred1)525
CTL epitope prediction (CTLpred)101
Prediction of interferon-gamma inducing peptides (IFNepitope)312
Prediction of IL4 inducing peptides (IL4pred)528