Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433633229
StrainM_canettii_CIPT_140010059
Protein IDYP_007266856.1
Description Conserved membrane protein of unknown function [Mycobacterium canet
Sequence MTSATIPGLDTAPTNHQGLLSWVEEVAELTQPDRVVFTDGSEEEFQRLCD
QLVEAGTFIRLNPEKHKNSYLALSDPSDVARVESRTFICSAKEIDAGPTN
NWMDPGEMRSIMKDLYRGCMRGRTMYVVPFCMGPLGAEDPKLGVEITDSE
YVVVSMRTMTRMGKAALEKMGDDGFFVKALHSVGAPLESGQKDVAWPCSE
TKYITHFPETREIWSYGSGYGGNALLGKKCYSLRIASAMAHDEGWLAEHM
LILKLISPENKAYYFAAAFPSACGKTNLAMLQPTIPGWRAETLGDDIAWM
RFGKDGRLYAVNPEFGFFGVAPGTNWKSNPNAMRTIAAGNTVFTNVALTD
DGDVWWEGLEGDPQHLIDWKGNDWYFRETETNAAHPNSRYCTPMSQCPIL
APEWDDPQGVPISGILFGGRRKTTVPLVTEARDWQHGVFIGATLGSEQTA
AAEGKVGNVRRDPMAMLPFLGYNVGDYFQHWINLGKHADESKLPKVFFVN
WFRRGDDGRFLWPGFGENSRVLKWIVDRIEHKAGGATTPIGTVPAVEDLD
LDGLDVDAADVAAALAVDADEWRQELPLIEEWLQFVGEKLPTGVKDEFDA
LKERLG
gene ID433633229
StrainM_canettii_CIPT_140070017
Protein IDYP_007266856.1
Description Conserved membrane protein of unknown function [Mycobacterium canet
Sequence MTSATIPGLDTAPTNHQGLLSWVEEVAELTQPDRVVFTDGSEEEFQRLCD
QLVEAGTFIRLNPEKHKNSYLALSDPSDVARVESRTFICSAKEIDAGPTN
NWMDPGEMRSIMKDLYRGCMRGRTMYVVPFCMGPLGAEDPKLGVEITDSE
YVVVSMRTMTRMGKAALEKMGDDGFFVKALHSVGAPLESGQKDVAWPCSE
TKYITHFPETREIWSYGSGYGGNALLGKKCYSLRIASAMAHDEGWLAEHM
LILKLISPENKAYYFAAAFPSACGKTNLAMLQPTIPGWRAETLGDDIAWM
RFGKDGRLYAVNPEFGFFGVAPGTNWKSNPNAMRTIAAGNTVFTNVALTD
DGDVWWEGLEGDPQHLIDWKGNDWYFRETETNAAHPNSRYCTPMSQCPIL
APEWDDPQGVPISGILFGGRRKTTVPLVTEARDWQHGVFIGATLGSEQTA
AAEGKVGNVRRDPMAMLPFLGYNVGDYFQHWINLGKHADESKLPKVFFVN
WFRRGDDGRFLWPGFGENSRVLKWIVDRIEHKAGGATTPIGTVPAVEDLD
LDGLDVDAADVAAALAVDADEWRQELPLIEEWLQFVGEKLPTGVKDEFDA
LKERLG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)9
Vaccine TargetYes
B cell prediction (LBtope)45
MHC class II prediction (Propred)66
MHC class 1 prediction (Propred1)414
CTL epitope prediction (CTLpred)80
Prediction of interferon-gamma inducing peptides (IFNepitope)230
Prediction of IL4 inducing peptides (IL4pred)436