Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433633304
StrainM_canettii_CIPT_140010059
Protein IDYP_007266931.1
Description ESX conserved componant EccC3 [Mycobacterium canettii CIPT 14007001
Sequence MSRLIFEARRRLAPPSSHQGTITIEAPPELPRVIPPSLLRRALPYLIGIL
IVGMIVALVATGMRVISPQTLFFPFVLLLAATALYRGNDKKMRTEEVDAE
RADYLRYLSVVRDNIRAQAAEQRASALWSHPDPTALASVPGSRRQWERDP
HDPDFLVLRAGRHRVPLATTLRVNDTADEIDLEPVSHSALRSLLDTQRSI
GDVPTGIDLTKVSRITVLGERAQVRAVLRAWIAQAVTWHDPTVLGVALAA
RDLEGRDWNWLKWLPHVDIPDRLDALGPARNLSTDPDELIALLGPVLADR
PAFTGQPTDALRHLLIVVDDPDYDLGASPLAVGRAGVTVVHCSASAPHRE
QYSDPEKPILRVAHGAIERWQTGGWQPYIDAADQFGADEAAHLARRLSRW
DSNPTHAGLRSAATRGASFTTLLGIEDASRLDVPALWAPRRRDEELRVPI
GVTGTGEPLMFDLKDEAEGGMGPHGLMIGMTGSGKSQTLMSILLSLLTTH
SAERLIVIYADFKGEAGADSFRDFPQVVAVISNMAEKKSLADRFADTLRG
EVARREMLLREAGRKVQGSAFNSVLEYENAIAAGHSLPPIPTLFVVADEF
TLMLADHPEYAELFDYVARKGRSFRIHILFASQTLDVGKIKDIDKNTAYR
IGLKVASPSVSRQIIGVEDAYHIESGKEHKGVGFLVPAPGATPIRFRSTY
VDGIYEPPQTAKAVVVQSVPEPKLFTAAAVEPDPGTVIADTDEQEPADPP
RKLIATIGEQLARYGPRAPQLWLTPLDETIPLSAALARAGVGPRQWRWPL
GEIDRPFEMRRDPLVFDARSSAGNMVIHGGPKSGKSTALQTFILSAASLH
SPHEVSFYCLDYGGGQLRALQDLAHVGSVASALEPERIRRTFGELEQLLL
SRQQREVFRDRGANGSTPDDGFGEVFLVIDNLYGFGRDNTDQFNTRNPLL
ARVTELVNVGLAYGIHVIITTPSWLEVPLAMRDGLGLRLELRLHDARDSN
VRVVGALRRPADAVPHDQPGRGLTMAAEHFLFAAPELDAQTNPVAAINAR
YPGMAAPPVRLLPTNLAPHAVGELYRGPDQLVIGQREEDLAPVILDFAAN
PLLMVFGDARSGKTTLLRHIIRTVREHSTADQVAFTVLDRRLHLVDEPLF
PDNEYTANIDRIIPAMLGLANLIEARRPPAGMSAAELSRWTFAGHTHYLI
IDDVDQVPDSPAMTGPYIGQRPWTPLIGLLAQAGDLGLRVIVTGRATGSA
HLLMTSPLLRRFNDLQATTLMLAGNPADSGKIRGERFARLPAGRAILLTD
SDSPTYVQLINPLVDAAAVSGETQQKGSQS
gene ID433633304
StrainM_canettii_CIPT_140070017
Protein IDYP_007266931.1
Description ESX conserved componant EccC3 [Mycobacterium canettii CIPT 14007001
Sequence MSRLIFEARRRLAPPSSHQGTITIEAPPELPRVIPPSLLRRALPYLIGIL
IVGMIVALVATGMRVISPQTLFFPFVLLLAATALYRGNDKKMRTEEVDAE
RADYLRYLSVVRDNIRAQAAEQRASALWSHPDPTALASVPGSRRQWERDP
HDPDFLVLRAGRHRVPLATTLRVNDTADEIDLEPVSHSALRSLLDTQRSI
GDVPTGIDLTKVSRITVLGERAQVRAVLRAWIAQAVTWHDPTVLGVALAA
RDLEGRDWNWLKWLPHVDIPDRLDALGPARNLSTDPDELIALLGPVLADR
PAFTGQPTDALRHLLIVVDDPDYDLGASPLAVGRAGVTVVHCSASAPHRE
QYSDPEKPILRVAHGAIERWQTGGWQPYIDAADQFGADEAAHLARRLSRW
DSNPTHAGLRSAATRGASFTTLLGIEDASRLDVPALWAPRRRDEELRVPI
GVTGTGEPLMFDLKDEAEGGMGPHGLMIGMTGSGKSQTLMSILLSLLTTH
SAERLIVIYADFKGEAGADSFRDFPQVVAVISNMAEKKSLADRFADTLRG
EVARREMLLREAGRKVQGSAFNSVLEYENAIAAGHSLPPIPTLFVVADEF
TLMLADHPEYAELFDYVARKGRSFRIHILFASQTLDVGKIKDIDKNTAYR
IGLKVASPSVSRQIIGVEDAYHIESGKEHKGVGFLVPAPGATPIRFRSTY
VDGIYEPPQTAKAVVVQSVPEPKLFTAAAVEPDPGTVIADTDEQEPADPP
RKLIATIGEQLARYGPRAPQLWLTPLDETIPLSAALARAGVGPRQWRWPL
GEIDRPFEMRRDPLVFDARSSAGNMVIHGGPKSGKSTALQTFILSAASLH
SPHEVSFYCLDYGGGQLRALQDLAHVGSVASALEPERIRRTFGELEQLLL
SRQQREVFRDRGANGSTPDDGFGEVFLVIDNLYGFGRDNTDQFNTRNPLL
ARVTELVNVGLAYGIHVIITTPSWLEVPLAMRDGLGLRLELRLHDARDSN
VRVVGALRRPADAVPHDQPGRGLTMAAEHFLFAAPELDAQTNPVAAINAR
YPGMAAPPVRLLPTNLAPHAVGELYRGPDQLVIGQREEDLAPVILDFAAN
PLLMVFGDARSGKTTLLRHIIRTVREHSTADQVAFTVLDRRLHLVDEPLF
PDNEYTANIDRIIPAMLGLANLIEARRPPAGMSAAELSRWTFAGHTHYLI
IDDVDQVPDSPAMTGPYIGQRPWTPLIGLLAQAGDLGLRVIVTGRATGSA
HLLMTSPLLRRFNDLQATTLMLAGNPADSGKIRGERFARLPAGRAILLTD
SDSPTYVQLINPLVDAAAVSGETQQKGSQS
B cell epitope (IEDB)0
T cell epitope (IEDB)1
MHC binder (IEDB)15
Vaccine TargetYes
B cell prediction (LBtope)190
MHC class II prediction (Propred)408
MHC class 1 prediction (Propred1)1860
CTL epitope prediction (CTLpred)438
Prediction of interferon-gamma inducing peptides (IFNepitope)1120
Prediction of IL4 inducing peptides (IL4pred)1714