Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433633312
StrainM_canettii_CIPT_140010059
Protein IDYP_007266939.1
Description ESX conserved component EccE3 [Mycobacterium canettii CIPT 14007001
Sequence MNPIPSWPGRGRVTLVLLAVVPVALAYPWQSTRDYVLLGVAAAVVIGLFG
FWRGLYFTTIARRGLAILRRRRRIAEPATCTRTTVLVWVGPPASDTNVLP
LTLIARYLDRYGIRADTIRITSRVTASGDRRTWVGLTVVADDNLAALQAR
SARIPLQETAQVAARRLADHLREIGWEAGTAAPDEIPALVAADSRETWRG
MRHTDSDYVSAYRVSADDELPDTLPAIRSRPAQETWTALEIAYAAGSSTR
YTVAAACALRTDSRPGGTAPVAGLIPQHGNHVPALTALDPRSTRRLDGHT
DAPADLLTRLHWPTPTAGAHRAPLTNAVSRT
gene ID433633312
StrainM_canettii_CIPT_140070017
Protein IDYP_007266939.1
Description ESX conserved component EccE3 [Mycobacterium canettii CIPT 14007001
Sequence MNPIPSWPGRGRVTLVLLAVVPVALAYPWQSTRDYVLLGVAAAVVIGLFG
FWRGLYFTTIARRGLAILRRRRRIAEPATCTRTTVLVWVGPPASDTNVLP
LTLIARYLDRYGIRADTIRITSRVTASGDRRTWVGLTVVADDNLAALQAR
SARIPLQETAQVAARRLADHLREIGWEAGTAAPDEIPALVAADSRETWRG
MRHTDSDYVSAYRVSADDELPDTLPAIRSRPAQETWTALEIAYAAGSSTR
YTVAAACALRTDSRPGGTAPVAGLIPQHGNHVPALTALDPRSTRRLDGHT
DAPADLLTRLHWPTPTAGAHRAPLTNAVSRT
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)30
MHC class II prediction (Propred)108
MHC class 1 prediction (Propred1)474
CTL epitope prediction (CTLpred)134
Prediction of interferon-gamma inducing peptides (IFNepitope)338
Prediction of IL4 inducing peptides (IL4pred)414