Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433634409
StrainM_canettii_CIPT_140010059
Protein IDYP_007268036.1
Description Putative polyketide synthase FadD33 [Mycobacterium canettii CIPT 14
Sequence MSELAAVLTRSMQASAGDLMVLDRETSLWCRHPWPEVHGLAESVAAWLLD
HDRPAAVGLVGEPTVELVAAIQGAWLAGAAVSILPGPVRGANDQRWADAT
LTRFIRIGVRTVLSQGSYLARLQSVDTAGVTIGDLSTAAYTNRSATPVAS
EGPAVLQGTAGSTGAPRTAILSPGAVLSNLRGLNQRVGTDAATDVGCSWL
PLYHDMGLAFVLSAALAGAPLWLAPTAAFTASPFRWLSWLSDSGATMTAA
PNFAYNLIGKYARRVSEVDLGALRVALNGGEPVDCDGLTRFAEVMAPFGF
DAGAVLPSYGLAESTCAVTVPVPGIGLLADRVIDGSGAHKHAVLGNPIPG
MEVRISCGDQAAGNASREIGEIEIRGASMMAGYLGQQPINPDDWFATGDL
GYLGAGGLVVCGRAKEVISIAGRNIFPTEVELVAAQVRGVREGAVVALGT
GDRSTRPGLVVAAEFRGPDEANARAELIQRVASECGVVPSDVVFVSPGSL
PRTSSGKLRRLAVRRSLEMAD
gene ID433634409
StrainM_canettii_CIPT_140070017
Protein IDYP_007268036.1
Description Putative polyketide synthase FadD33 [Mycobacterium canettii CIPT 14
Sequence MSELAAVLTRSMQASAGDLMVLDRETSLWCRHPWPEVHGLAESVAAWLLD
HDRPAAVGLVGEPTVELVAAIQGAWLAGAAVSILPGPVRGANDQRWADAT
LTRFIRIGVRTVLSQGSYLARLQSVDTAGVTIGDLSTAAYTNRSATPVAS
EGPAVLQGTAGSTGAPRTAILSPGAVLSNLRGLNQRVGTDAATDVGCSWL
PLYHDMGLAFVLSAALAGAPLWLAPTAAFTASPFRWLSWLSDSGATMTAA
PNFAYNLIGKYARRVSEVDLGALRVALNGGEPVDCDGLTRFAEVMAPFGF
DAGAVLPSYGLAESTCAVTVPVPGIGLLADRVIDGSGAHKHAVLGNPIPG
MEVRISCGDQAAGNASREIGEIEIRGASMMAGYLGQQPINPDDWFATGDL
GYLGAGGLVVCGRAKEVISIAGRNIFPTEVELVAAQVRGVREGAVVALGT
GDRSTRPGLVVAAEFRGPDEANARAELIQRVASECGVVPSDVVFVSPGSL
PRTSSGKLRRLAVRRSLEMAD
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)35
MHC class II prediction (Propred)76
MHC class 1 prediction (Propred1)356
CTL epitope prediction (CTLpred)84
Prediction of interferon-gamma inducing peptides (IFNepitope)207
Prediction of IL4 inducing peptides (IL4pred)313