Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433634578
StrainM_canettii_CIPT_140010059
Protein IDYP_007268205.1
Description Conserved protein of unknown function [Mycobacterium canettii CIPT
Sequence MSRNPRPPEGAKQVMAPEHSAGAAQFTAHNVRLDDGTLTMPESSRTLDES
SWFISARGILETVFPGDKSHLRLADVGCLEGGYAVGFARLGFQVLGIEVR
ELNMAACNYIKSKTNLPNLRFVHDNALNIANHGLFDAVFCCGLFYHLENP
RQYLETLSSVTNKLLILQTHFSIINRSDKWLRLPTTARQLTDRLLRRPAP
VKFMLSAPTEHEGLPGRWFTEFTDDRSFGQRDTAKWASWDNRRSFWIQRE
HLLQAIKDVGFDLVMEEYDNLEPSIAESLLGGSYAANLRGTFIGIKTR
gene ID433634578
StrainM_canettii_CIPT_140070017
Protein IDYP_007268205.1
Description Conserved protein of unknown function [Mycobacterium canettii CIPT
Sequence MSRNPRPPEGAKQVMAPEHSAGAAQFTAHNVRLDDGTLTMPESSRTLDES
SWFISARGILETVFPGDKSHLRLADVGCLEGGYAVGFARLGFQVLGIEVR
ELNMAACNYIKSKTNLPNLRFVHDNALNIANHGLFDAVFCCGLFYHLENP
RQYLETLSSVTNKLLILQTHFSIINRSDKWLRLPTTARQLTDRLLRRPAP
VKFMLSAPTEHEGLPGRWFTEFTDDRSFGQRDTAKWASWDNRRSFWIQRE
HLLQAIKDVGFDLVMEEYDNLEPSIAESLLGGSYAANLRGTFIGIKTR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)32
MHC class II prediction (Propred)102
MHC class 1 prediction (Propred1)424
CTL epitope prediction (CTLpred)98
Prediction of interferon-gamma inducing peptides (IFNepitope)194
Prediction of IL4 inducing peptides (IL4pred)392