Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433634809
StrainM_canettii_CIPT_140010059
Protein IDYP_007268436.1
Description Phospholipase C 4 (MTP40 antigen) [Mycobacterium canettii CIPT 1400
Sequence MRLEVRQENTAVSQSHIGGVSRREFLAKVAAGGAGALMSFAGPVIEKAYG
AGPCSGHLTDIEHFVFFMQENRSFDHYFGTLSGTDGFNTVSPLFQQKGWN
PMTQALDATGVTLPYRFDTTRGPFLDGACVNDPDHSWVAMHESWNGGVND
NWLPAQAKTRSAAHTPTVMGYYTRQDIPIHYLLADAFTVCDRYFCSVLGP
TLPNRLYWLSATIDPDGQNGGPELQSPTFQPVRRFGWRIMPQNLSDAGVS
WKVYRNKTLGPISSVLTYGSLVTSFKQSADPRSDLVRFGVAPSYPASFAA
DVLANRLPRVSWVIPNVLESEHPAVPAAAGAFAIVNILRILLANPAVWEK
TALIVSYDENGGFFDHVVPATAPAGTPGEYVTVPDIDQVPGSGGIRGPIG
LGFRVPCFVISPYSRGPQMVHDTFDHTSQLRLLETRFGVPVPNLTAWRRS
VTGDMTSTFNFAVPPNSSWPNLDYPGLHALSTVPQCVPNAALGTINRGIP
YRVPDPQIMPTQETTPTRGIPSGPC
gene ID433634809
StrainM_canettii_CIPT_140070017
Protein IDYP_007268436.1
Description Phospholipase C 4 (MTP40 antigen) [Mycobacterium canettii CIPT 1400
Sequence MRLEVRQENTAVSQSHIGGVSRREFLAKVAAGGAGALMSFAGPVIEKAYG
AGPCSGHLTDIEHFVFFMQENRSFDHYFGTLSGTDGFNTVSPLFQQKGWN
PMTQALDATGVTLPYRFDTTRGPFLDGACVNDPDHSWVAMHESWNGGVND
NWLPAQAKTRSAAHTPTVMGYYTRQDIPIHYLLADAFTVCDRYFCSVLGP
TLPNRLYWLSATIDPDGQNGGPELQSPTFQPVRRFGWRIMPQNLSDAGVS
WKVYRNKTLGPISSVLTYGSLVTSFKQSADPRSDLVRFGVAPSYPASFAA
DVLANRLPRVSWVIPNVLESEHPAVPAAAGAFAIVNILRILLANPAVWEK
TALIVSYDENGGFFDHVVPATAPAGTPGEYVTVPDIDQVPGSGGIRGPIG
LGFRVPCFVISPYSRGPQMVHDTFDHTSQLRLLETRFGVPVPNLTAWRRS
VTGDMTSTFNFAVPPNSSWPNLDYPGLHALSTVPQCVPNAALGTINRGIP
YRVPDPQIMPTQETTPTRGIPSGPC
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)44
MHC class II prediction (Propred)71
MHC class 1 prediction (Propred1)344
CTL epitope prediction (CTLpred)79
Prediction of interferon-gamma inducing peptides (IFNepitope)187
Prediction of IL4 inducing peptides (IL4pred)383