Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433636231
StrainM_canettii_CIPT_140010059
Protein IDYP_007269858.1
Description NADH-quinone oxidoreductase subunit G [Mycobacterium canettii CIPT
Sequence MTQAADTDTRVAQPEMVTLTIDDVEISVPKGTLVIRAAELMGIQIPRFCD
HPLLEPVGACRQCLVEVEGQRKPLASCTTVATDDMVVRTQLTSEIADKAQ
HGVMELLLINHPLDCPMCDKGGECPLQNQAMSNGRTDSRFTEDKRTFAKP
INISAQVLLDRERCILCARCTRFSDQIAGDPFIDMQERGALQQVGIYADE
PFESYFSGNTVQICPVGALTGTAYRFRARPFDLVSSPSVCEHCASGCAQR
TDHRRGKVLRRLAGDDPEVNEEWNCDKGRWSFTYATQPDVITTPLIRDGG
DPKGALVPTSWSHAMAVAARGLAAARGRTGVLVGGRVTWEDAYAYAKFAR
ITLGTNDIDFRARPHSAEEADFLAARIAGRHMAVSYADLESAPVVLLVGF
EPEDESPIVFLRLRKAARRHRVPVYAIAPFATGGLHKMSGRLIKTVPGAE
PAALDDLATGAVGDLLATPGAVIMVGERLATVPGGLSAAARLADTTGARL
AWVPRRAGERGALEAGALPTLLPGGRPLADEVARAQVCAAWHVAELPAAA
GRDADGILAAAGDETLAALLVGGIEPADFADPDAVLAALDATGFVVSLEL
RHSAVTERADVVFPVAPTTQKAGAFVNWEGRYRTFEPALRGSMSQAGQSD
HRVLDALADDMGVHLGVPTVEAAREELAALGIWDGKHAAGPHIAATGPTQ
PEAGEAILTGWRMLLDEGRLQDGEPYLAGTARTPVVRLSPETAAEIGAAD
GEAVTVSTSRGSITLPCSVTDMPDRVVWLPLNSAGSTVHRQLRVTIGSIV
KIGAGS
gene ID433636231
StrainM_canettii_CIPT_140010059
Protein IDYP_007269858.1
Description NADH-quinone oxidoreductase subunit G [Mycobacterium canettii CIPT
Sequence MTQAADTDTRVAQPEMVTLTIDDVEISVPKGTLVIRAAELMGIQIPRFCD
HPLLEPVGACRQCLVEVEGQRKPLASCTTVATDDMVVRTQLTSEIADKAQ
HGVMELLLINHPLDCPMCDKGGECPLQNQAMSNGRTDSRFTEDKRTFAKP
INISAQVLLDRERCILCARCTRFSDQIAGDPFIDMQERGALQQVGIYADE
PFESYFSGNTVQICPVGALTGTAYRFRARPFDLVSSPSVCEHCASGCAQR
TDHRRGKVLRRLAGDDPEVNEEWNCDKGRWSFTYATQPDVITTPLIRDGG
DPKGALVPTSWSHAMAVAARGLAAARGRTGVLVGGRVTWEDAYAYAKFAR
ITLGTNDIDFRARPHSAEEADFLAARIAGRHMAVSYADLESAPVVLLVGF
EPEDESPIVFLRLRKAARRHRVPVYAIAPFATGGLHKMSGRLIKTVPGAE
PAALDDLATGAVGDLLATPGAVIMVGERLATVPGGLSAAARLADTTGARL
AWVPRRAGERGALEAGALPTLLPGGRPLADEVARAQVCAAWHVAELPAAA
GRDADGILAAAGDETLAALLVGGIEPADFADPDAVLAALDATGFVVSLEL
RHSAVTERADVVFPVAPTTQKAGAFVNWEGRYRTFEPALRGSMSQAGQSD
HRVLDALADDMGVHLGVPTVEAAREELAALGIWDGKHAAGPHIAATGPTQ
PEAGEAILTGWRMLLDEGRLQDGEPYLAGTARTPVVRLSPETAAEIGAAD
GEAVTVSTSRGSITLPCSVTDMPDRVVWLPLNSAGSTVHRQLRVTIGSIV
KIGAGS
gene ID433636231
StrainM_canettii_CIPT_140070017
Protein IDYP_007269858.1
Description NADH-quinone oxidoreductase subunit G [Mycobacterium canettii CIPT
Sequence MTQAADTDTRVAQPEMVTLTIDDVEISVPKGTLVIRAAELMGIQIPRFCD
HPLLEPVGACRQCLVEVEGQRKPLASCTTVATDDMVVRTQLTSEIADKAQ
HGVMELLLINHPLDCPMCDKGGECPLQNQAMSNGRTDSRFTEDKRTFAKP
INISAQVLLDRERCILCARCTRFSDQIAGDPFIDMQERGALQQVGIYADE
PFESYFSGNTVQICPVGALTGTAYRFRARPFDLVSSPSVCEHCASGCAQR
TDHRRGKVLRRLAGDDPEVNEEWNCDKGRWSFTYATQPDVITTPLIRDGG
DPKGALVPTSWSHAMAVAARGLAAARGRTGVLVGGRVTWEDAYAYAKFAR
ITLGTNDIDFRARPHSAEEADFLAARIAGRHMAVSYADLESAPVVLLVGF
EPEDESPIVFLRLRKAARRHRVPVYAIAPFATGGLHKMSGRLIKTVPGAE
PAALDDLATGAVGDLLATPGAVIMVGERLATVPGGLSAAARLADTTGARL
AWVPRRAGERGALEAGALPTLLPGGRPLADEVARAQVCAAWHVAELPAAA
GRDADGILAAAGDETLAALLVGGIEPADFADPDAVLAALDATGFVVSLEL
RHSAVTERADVVFPVAPTTQKAGAFVNWEGRYRTFEPALRGSMSQAGQSD
HRVLDALADDMGVHLGVPTVEAAREELAALGIWDGKHAAGPHIAATGPTQ
PEAGEAILTGWRMLLDEGRLQDGEPYLAGTARTPVVRLSPETAAEIGAAD
GEAVTVSTSRGSITLPCSVTDMPDRVVWLPLNSAGSTVHRQLRVTIGSIV
KIGAGS
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)1
Vaccine TargetYes
B cell prediction (LBtope)130
MHC class II prediction (Propred)176
MHC class 1 prediction (Propred1)1090
CTL epitope prediction (CTLpred)234
Prediction of interferon-gamma inducing peptides (IFNepitope)708
Prediction of IL4 inducing peptides (IL4pred)1136