Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433636387
StrainM_canettii_CIPT_140010059
Protein IDYP_007270014.1
Description RNA polymerase Sigma-F factor [Mycobacterium canettii CIPT 14007001
Sequence MTARAAGGSASRANEYADVPEMFRELVGLPAGSPEFQRHRDKIVQRCLPL
ADHIARRFEGRGEPRDDLIQVARVGLVNAAVRFDVKTGSDFVSFAVPTIM
GEVRRHFRDNSWSVKVPRRLKELHLRLGTATADLSQRLGRAPSASELAAE
LGMDRAEVIEGLLAGSSYHTLSIDSGGGSDDDARAITDTLGDVDAGLDQI
ENREVLRPLLEALPERERTVLVLRFFDSLTQTQIAERVGISQMHVSRLLA
KSLARLRDQLE
gene ID433636387
StrainM_canettii_CIPT_140010059
Protein IDYP_007270014.1
Description RNA polymerase Sigma-F factor [Mycobacterium canettii CIPT 14007001
Sequence MTARAAGGSASRANEYADVPEMFRELVGLPAGSPEFQRHRDKIVQRCLPL
ADHIARRFEGRGEPRDDLIQVARVGLVNAAVRFDVKTGSDFVSFAVPTIM
GEVRRHFRDNSWSVKVPRRLKELHLRLGTATADLSQRLGRAPSASELAAE
LGMDRAEVIEGLLAGSSYHTLSIDSGGGSDDDARAITDTLGDVDAGLDQI
ENREVLRPLLEALPERERTVLVLRFFDSLTQTQIAERVGISQMHVSRLLA
KSLARLRDQLE
gene ID433636387
StrainM_canettii_CIPT_140070017
Protein IDYP_007270014.1
Description RNA polymerase Sigma-F factor [Mycobacterium canettii CIPT 14007001
Sequence MTARAAGGSASRANEYADVPEMFRELVGLPAGSPEFQRHRDKIVQRCLPL
ADHIARRFEGRGEPRDDLIQVARVGLVNAAVRFDVKTGSDFVSFAVPTIM
GEVRRHFRDNSWSVKVPRRLKELHLRLGTATADLSQRLGRAPSASELAAE
LGMDRAEVIEGLLAGSSYHTLSIDSGGGSDDDARAITDTLGDVDAGLDQI
ENREVLRPLLEALPERERTVLVLRFFDSLTQTQIAERVGISQMHVSRLLA
KSLARLRDQLE
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)42
MHC class II prediction (Propred)70
MHC class 1 prediction (Propred1)354
CTL epitope prediction (CTLpred)96
Prediction of interferon-gamma inducing peptides (IFNepitope)260
Prediction of IL4 inducing peptides (IL4pred)370