Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433636955
StrainM_canettii_CIPT_140010059
Protein IDYP_007270582.1
Description Monooxygenase EthA [Mycobacterium canettii CIPT 140070017]
Sequence MTEHLDVVIVGAGISGVSAAWHLQDRCPTKSYAILEKREAMGGTWDLFRY
PGIRSDSDMYTLGFRFRPWTGRQAIADGKPILEYVKSTAAIYGIDRHIRF
HHKVISADWSTAENRWTVHIQSHGTLSTLTCEFLFLCSGYYNYDEGYSPR
FAGSEDFAGPIIHPQHWPEDLDYDAKNIVVIGSGATAVTLVPALADSGAK
HVTMLQRSPTYIVSQPDRDGIAEKLNRWLPETMAYTAVRWKNVLRQAAVY
SACQKWPRRMRKMFLGLIQRQLPEGYDVRKHFGPHYNPWDQRLCLVPNGD
LFRAIRHGKVEVVTDTIERFTATGIRLNSGRELPADIIITATGLNLQLFG
GATATIDGQQVDITTTMAYKGMMLSGIPNMAYTVGYTNASWTLKADLVSE
FVCRLLNYMDDNGFDTVVVERPGSDVEERPFMEFTPGYVLRSLDELPKQG
SRTPWRLNQNYLRDIRLIRRGKIDDEGLRFAKRPAPVGV
gene ID433636955
StrainM_canettii_CIPT_140070017
Protein IDYP_007270582.1
Description Monooxygenase EthA [Mycobacterium canettii CIPT 140070017]
Sequence MTEHLDVVIVGAGISGVSAAWHLQDRCPTKSYAILEKREAMGGTWDLFRY
PGIRSDSDMYTLGFRFRPWTGRQAIADGKPILEYVKSTAAIYGIDRHIRF
HHKVISADWSTAENRWTVHIQSHGTLSTLTCEFLFLCSGYYNYDEGYSPR
FAGSEDFAGPIIHPQHWPEDLDYDAKNIVVIGSGATAVTLVPALADSGAK
HVTMLQRSPTYIVSQPDRDGIAEKLNRWLPETMAYTAVRWKNVLRQAAVY
SACQKWPRRMRKMFLGLIQRQLPEGYDVRKHFGPHYNPWDQRLCLVPNGD
LFRAIRHGKVEVVTDTIERFTATGIRLNSGRELPADIIITATGLNLQLFG
GATATIDGQQVDITTTMAYKGMMLSGIPNMAYTVGYTNASWTLKADLVSE
FVCRLLNYMDDNGFDTVVVERPGSDVEERPFMEFTPGYVLRSLDELPKQG
SRTPWRLNQNYLRDIRLIRRGKIDDEGLRFAKRPAPVGV
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)56
MHC class II prediction (Propred)180
MHC class 1 prediction (Propred1)676
CTL epitope prediction (CTLpred)166
Prediction of interferon-gamma inducing peptides (IFNepitope)366
Prediction of IL4 inducing peptides (IL4pred)670