Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433636982
StrainM_canettii_CIPT_140070017
Protein IDYP_007270609.1
Description ESX conserved componant EccE1 [Mycobacterium canettii CIPT 14007001
Sequence MRNPLGLRFSTGHTLLASALAPPCIIAFLETRYWWVGIALASLGVIVAMV
TFYGRRITGWVAAVYAWLRRRRRPPDSSSEPVVGATVKPGDHVAVRWQGE
FLVAVIELIPRPFTPTVIVDGQAHTDDMLDTGLVEELLSVHCPDLEADIV
SAGYRVGNTAAPDVVSLYQQVIGTDPAPANRRTWIVLRADPERTRKSAQR
RDEGVAGLARYLVASATRIADRLASHGVDAVCGRSFDDYDHATDIGFVRE
KWSMIKGRDAYTAAYAAPGGPDVWWSARADHTITRVRVAPGMAPQSTVLL
TTADKPKTPRGFARLFGGQRPALQGQHLVANRHCQLPIGSAGVLVGETVN
RCPVYMPFDDVDIALNLGDAQTFTQFVVRAAAAGAMVTVGPQFEEFARLI
GAHIGQEVKVTWPNATTYLGPHPGIDRVILRHNVIGTPRHRQLPIRRVSP
PEESRYQMALPK
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)29
MHC class II prediction (Propred)74
MHC class 1 prediction (Propred1)322
CTL epitope prediction (CTLpred)79
Prediction of interferon-gamma inducing peptides (IFNepitope)209
Prediction of IL4 inducing peptides (IL4pred)315