Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433640330
StrainM_canettii_CIPT_140070008
Protein IDYP_007286089.1
Description Putative zinc metalloprotease [Mycobacterium canettii CIPT 14007000
Sequence MTLAIPSGIDLSHIDADARPQDDLFGHVNGRWLAEHEIPADRATDGAFRS
LFDRAEKQVRDLIIQASQAGAAVGTDAQRIGDLYASFLDEEAVERAGVQP
LHHELATLDSAADATELAAALGALQRAGVGGGIGVYVDTDSKDSTRYLVH
FTQSGIGLPDESYYRDEQHAAVLAAYPGHIARMFSLVYGGESRDHAKTAD
RIVALETKLADAHWDVVKRRDADLGYNLRTFAQLQTEGAGFDWVSWVTAL
GSAPDAMTELVVRQPDYLVTFASLWASVNVEDWKCWARWRLIRARAPWLT
RALVAEDFEFYGRTLTGAQQLRDRWKRGVSLVENLMGDAVGKLYVQRHFP
PDAKARIDTLVDNLQEAYRISISELDWMTPQTRQRALAKLNKFTAKVGYP
IKWRDYSKLAIDRDDLYGNVQRGYAVNHDRELAKLFGPVDRDEWFMTPQT
VNAYYNPGMNEIVFPAAILQPPFFDPQADEAANYGGIGAVIGHEIGHGFD
DQGAKYDGDGNLVDWWTDDDRTEFAARTEALIEQYHAYTPRDLVDHPGPP
HVQGAFTIGENIGDLGGLSIALLAYQLSLNGNPAPVIDGLTGTQRVFFGW
AQIWRTKSRAAEAIRRLAVDPHSPPEFRCNGVVRNVDAFYEAFDVTEDDA
LFLDPQRRVRIWN
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)1
Vaccine TargetYes
B cell prediction (LBtope)58
MHC class II prediction (Propred)91
MHC class 1 prediction (Propred1)451
CTL epitope prediction (CTLpred)116
Prediction of interferon-gamma inducing peptides (IFNepitope)303
Prediction of IL4 inducing peptides (IL4pred)421