Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433640353
StrainM_canettii_CIPT_140070008
Protein IDYP_007286112.1
Description Putative triacylglycerol synthase (diacylglycerol acyltransferase)
Sequence MKRLSGWDAVLLYSETPNVHMHTLKVAVIELDSDRQEFGVDAFREVIAGR
LHKLEPLGYQLVDVPLKFHHPMWREHCQVDLNYHIRPWRLRAPGGRRELD
EAVGEIASTPLNRDHPLWEMYFVEGLADHRIAVVAKIHHALADGVASANM
MARGMDLLPGPEVGRYVPDPAPTKRQLLSAAFIDHLRHLGRIPATIRYTT
QGLGRVRRSSRKLSPALTMPFTPPPTFMNHRLTPERRFATATLALIDVKA
TAKLLGATINDMVLAMSTGALRTLLLRYDGKAEPLLASVPVSYDFSPERI
SGNRFTGMLVALPADSDDPLQRVRVCHENAVSAKESHQLLGPELISRWAA
YWPPAGAEALFRWLSERDGQNKVLNLNISNVPGPRERGRVGGALVTEIYS
VGPLTAGSGLNITVWSYVDQLNISVLTDGSTVQDPHEVTAGMIADFIEIR
RAAGLSVELTVVESAMAQA
B cell epitope (IEDB)0
T cell epitope (IEDB)1
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)56
MHC class II prediction (Propred)71
MHC class 1 prediction (Propred1)324
CTL epitope prediction (CTLpred)88
Prediction of interferon-gamma inducing peptides (IFNepitope)187
Prediction of IL4 inducing peptides (IL4pred)335