Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433641790
StrainM_canettii_CIPT_140070008
Protein IDYP_007287549.1
Description Conserved protein of unknown function- PE-PGRS family protein [Myco
Sequence MSFLLVEPDLVTAAAANLAGIRSALSEAAAAASTPTTALASAGADEVSAA
VSRLFGAYGQQFQALNARAATFHAEFVSLLNGGAAAYTGAEAASVSSMQA
LLDAVNAPTQTLLGRPLIGNGADGVAGTGSNAGGNGGPGGILYGNGGNGG
AGGPDGGAGGNGGAAGLIGNGGAGGAGGAGGAGGAGGAGGTGGLLYGNGG
AGGNGGSATAAGGAGGNALLFGNGGNGGSGASGGAAGHAGTVYGNGGNAG
AGSGLAGADGGLFGNGGTGGSSTSKAGGAGGNALFGNGGDGGSSTVAAGG
AGGNTLVGNGGAGGAGGTSGLTGSGVAGGAGGSVGLWGSGGAGGNGGAAT
SLLGVGMNAGAGGAGGNAGLLYGNGGAGGAGGNGGDTTVPLFDSGVGGAG
GAGGNASLFGNGGTGGVGGKGGTSSDLASATSGAGGAGGAGGVGGLLYGN
GGNGGAGGIGGAAINILANAGAGGAGGAAGSSFIGNGGNGGAGGAGGAAA
LFSSGVGGAGGSGGTALLLGSGGAGGNGGTGGANSGSLFASPGGTGGAGG
HGGAGGLIWGNGGAGGNGGNGGTTADGALEGGTGGIGGTGGSAIAFGNGG
HGGAGGTGGDHTGGNGIGGKGGASGNGGNAGQVFGDGGTGGTGGAGGAGS
GTKAGGTGSDGGHGGNATLIGNGGDGGAGGAGGAGSPAGAPGNGGTGGTG
GVLFGQSGSSGPPGAAALAFPSLSSSVPILGPYEDLIANTVANLASIGNT
WLADPAPFLQQYLANQFGYGQLTLTALTDATRDFAIGLAGIPPSLQSALQ
ALAAGDVSGAVTDVLGAVVKVFVSGVDASDLSNILLLGPVGDLFPILSIP
GAMSQNFTNVVMTLTDTTIAFSIDTTNLTGVMTFGLPLAMTLNAVGSPIT
TAIAFAESTTAFVSAVQAGNLQAAAAALVGAPANVANGFLNGEARLPLAL
PTSATGGIPVTVEVPVGGILAPLQPFQATAVIPVIGPVTVTLEGTPAGGI
VPALVNYAPTQLAQAIAA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)170
MHC class II prediction (Propred)75
MHC class 1 prediction (Propred1)511
CTL epitope prediction (CTLpred)79
Prediction of interferon-gamma inducing peptides (IFNepitope)570
Prediction of IL4 inducing peptides (IL4pred)452