Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433642069
StrainM_canettii_CIPT_140070008
Protein IDYP_007287828.1
Description Putative monooxygenase [Mycobacterium canettii CIPT 140070008]
Sequence MEIGIFLMPAHPPERALYDATQWDLDIIELADQLGYVEAWVGEHFTVPWE
PICAPDLLLAQALLRTKRIKLAPGAHLLPYHHPVELAHRVAYFDHLAQGR
FMLGVGASGIPGDWALYDVDGKNGEHREMTREALEIMLRIWTEDEPWEHR
GKYWNANGIAPMFEGLMRRHIKPYQKPHPPIGVTGFSAGSETLKLAGERG
YIPMSLDLNTEYVATHWDAVLAGAQRSGRTPHRRDWRLVREVLVAETDEQ
AFRYAVDGTMGRAMREYVLPTFRMFGMTKFYKHNPSVPDDEVTPEYLAEN
TFVVGSVQTVVDKLEATYDQVGGFGHLLILGFDYSDNPGPWKESLRLLAH
EVMPRLNARLATKPAIAVV
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)1
Vaccine TargetYes
B cell prediction (LBtope)11
MHC class II prediction (Propred)55
MHC class 1 prediction (Propred1)245
CTL epitope prediction (CTLpred)59
Prediction of interferon-gamma inducing peptides (IFNepitope)153
Prediction of IL4 inducing peptides (IL4pred)246