Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433642098
StrainM_canettii_CIPT_140070008
Protein IDYP_007287857.1
Description Conserved membrane protein of unknown function- YrbE3a [Mycobacteri
Sequence MVIAADKAAGRVADPVLRPVGALGDFFAMTLDTFVCMFKPPFAWREYLLQ
CWFVARVSTLPGVLMTIPWAVISGFLFNVLLTDIGAADFSGTGCAIFTVN
QSAPIVTVLVVAGAGATAMCADLGARTIREELDALRVMGINPIQALAAPR
VLAATTVSLALNSVVTATGLIGAFFCSVFLMHVSAGAWVTGLTTLTHTVD
VVISMIKATLFGLMAGLIACYKGMSVGGGPAGVGRAVNETVVFAFIVLFV
INIVVTAVGIPFMVS
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)11
MHC class II prediction (Propred)67
MHC class 1 prediction (Propred1)192
CTL epitope prediction (CTLpred)64
Prediction of interferon-gamma inducing peptides (IFNepitope)128
Prediction of IL4 inducing peptides (IL4pred)196