Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433642121
StrainM_canettii_CIPT_140070008
Protein IDYP_007287880.1
Description Conserved membrane protein of unknown function [Mycobacterium canet
Sequence MVGPRTGGYAIHKLGFCSVVMLGINSIVGAGIFLTPGEVIGLAGPFAPMA
YVLAGIFAGVVAIVFATAARYVRTNGASYAYTTAAFGRRIGIYVGVTHAI
TASIAWGVLASFFVSTLLRVAFPDKAWADAEQLFSVKTLTFLGFIGVLLA
INLFGNRAIKWANGTSTVGKAFALSAFIVGGLWIITTQHVNNYATAWSAY
SATPYSLLGVAEIGKGTFSSLALATIVALYAFTGFESIANAAEEMDAPDR
NLPRAIPIAIFSVGAIYLLALTVAMLLGSNKIAASGDTVKLAAAIGNATF
RTIIVVGALISMFGINVAASFGAPRLWTALADSGVLPTRLSRKNQYDVPM
VSFAITASLALAFPLALRFDNLHLTGLAVIARFVQFIIVPIALIALARSQ
AVEHAAVRRNAFTDKVLPLVAIVVSVGLAVSYDYRCIFLVRGGPNYFSIA
LIVITFIVVPAMAYLHYYRIIRRVGDRPSTH
B cell epitope (IEDB)3
T cell epitope (IEDB)5
MHC binder (IEDB)12
Vaccine TargetYes
B cell prediction (LBtope)30
MHC class II prediction (Propred)131
MHC class 1 prediction (Propred1)380
CTL epitope prediction (CTLpred)114
Prediction of interferon-gamma inducing peptides (IFNepitope)167
Prediction of IL4 inducing peptides (IL4pred)295