Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433642232
StrainM_canettii_CIPT_140070008
Protein IDYP_007287991.1
Description Putative precorrin-6Y methyltransferase CobL [Mycobacterium canetti
Sequence MIIVVGIGADGMTGLSEHSRSELRRATVIYGSKRQLALLDDTVTAERWEW
PTPMLPAVQGLSPDGADLHVVASGDPLLHGIGSTLIRLFGHDNVTVLPHV
SAVTLACARMGWNVYDTEVISLVTAQPHTAVRRGGRAIVLSGDRSTPQAL
AVLLTEHGRGDSKFSVLEQLGGPAERRRDGTARAWACDPPLDVDELNVIA
VRYLPDERTSWAPDEAFAHDGQITKHPIRVLTLAALAPRPGQRLWDVGAG
SGAIAVQWCRSWPGCTAVAFERDERRRRNIGFNAAAFGVSVDVRGDAPDA
FDDAARPSVIFLGGGVTQPGLLEACLDSLPAGGNLVANAVTVESEAALAH
AYSRLGGELRRFQHYLGEPLGGFTGWRPQLPVTQWSVTKR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)31
MHC class II prediction (Propred)53
MHC class 1 prediction (Propred1)247
CTL epitope prediction (CTLpred)63
Prediction of interferon-gamma inducing peptides (IFNepitope)157
Prediction of IL4 inducing peptides (IL4pred)225