Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433642477
StrainM_canettii_CIPT_140070008
Protein IDYP_007288236.1
Description Conserved lipoprotein of unknown function- LppO [Mycobacterium cane
Sequence MTDPRHTVRIAVGATALGVSALGATLPACSAHSGPGSPPSAPSAPAAATV
MVEGHTHTISGAVECRTSPAVRTATPSESGTQTTRVNAHDDSASVTLSLS
DSTPPDVNGFGISLKIGSVDYQMPYQPVQSPTQVEATRQGKSYTLTGTGH
AVIPGQSGMRELPFGVHVTCP
B cell epitope (IEDB)0
T cell epitope (IEDB)2
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)10
MHC class II prediction (Propred)9
MHC class 1 prediction (Propred1)101
CTL epitope prediction (CTLpred)15
Prediction of interferon-gamma inducing peptides (IFNepitope)72
Prediction of IL4 inducing peptides (IL4pred)108