Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433643594
StrainM_canettii_CIPT_140070008
Protein IDYP_007289353.1
Description Conserved protein of unknown function [Mycobacterium canettii CIPT
Sequence MTILILTDNVHAHALAVDLQARHGDMDVYQSPIGQLPGVPRCDVAERVAE
IVERYDLVLSFHCKQRFPAALIDGVRCVNVHPGFNPYNRGWFPQVFSIID
GQKVGVTIHEIDDQLDHGPIIAQRECAIESWDSSGSVYARLMDIERELVL
EHFDAIRDGSYTAKSPATEGNLNLKKDFEQLRRLDLNERGTFGHFLNRLR
ALTHDDFRNAWFVDASGRKVFVRVVLEPEKPVEA
gene ID433643594
StrainM_canettii_CIPT_140070008
Protein IDYP_007289353.1
Description Conserved protein of unknown function [Mycobacterium canettii CIPT
Sequence MTILILTDNVHAHALAVDLQARHGDMDVYQSPIGQLPGVPRCDVAERVAE
IVERYDLVLSFHCKQRFPAALIDGVRCVNVHPGFNPYNRGWFPQVFSIID
GQKVGVTIHEIDDQLDHGPIIAQRECAIESWDSSGSVYARLMDIERELVL
EHFDAIRDGSYTAKSPATEGNLNLKKDFEQLRRLDLNERGTFGHFLNRLR
ALTHDDFRNAWFVDASGRKVFVRVVLEPEKPVEA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)20
MHC class II prediction (Propred)40
MHC class 1 prediction (Propred1)151
CTL epitope prediction (CTLpred)48
Prediction of interferon-gamma inducing peptides (IFNepitope)72
Prediction of IL4 inducing peptides (IL4pred)195