Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID440579615
StrainMtb_7199-99
Protein IDCCG10018.1
Description putative FATTY-ACID-CoA LIGASE FADD5 (FATTY-ACID-CoA SYNTHETASE) (FATTY
Sequence MTAQLASHLTRALTLAQQQPYLARRQNWVNQLERHAMMQPDAPALRFVGN
TMTWADLRRRVAALAGALSGRGVGFGDRVMILMLNRTEFVESVLAANMIG
AIAVPLNFRLTPTEIAVLVEDCVAHVMLTEAALAPVAIGVRNIQPLLSVI
VVAGGSSQDSVFGYEDLLNEAGDVHEPVDIPNDSPALIMYTSGTTGRPKG
AVLTHANLTGQAMTALYTSGANINSDVGFVGVPLFHIAGIGNMLTGLLLG
LPTVIYPLGAFDPGQLLDVLEAEKVTGIFLVPAQWQAVCTEQQARPRDLR
LRVLSWGAAPAPDALLRQMSATFPETQILAAFGQTEMSPVTCMLLGEDAI
AKRGSVGRVIPTVAARVVDQNMNDVPVGEVGEIVYRAPTLMSCYWNNPEA
TAEAFAGGWFHSGDLVRMDSDGYVWVVDRKKDMIISGGENIYCAELENVL
ASHPDIAEVAVIGRADEKWGEVPIAVAAVTNDDLRIEDLGEFLTDRLARY
KHPKALEIVDALPRNPAGKVLKTELRLRYGACVNVERRSASAGFTERREN
RQKL
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)38
MHC class II prediction (Propred)88
MHC class 1 prediction (Propred1)387
CTL epitope prediction (CTLpred)101
Prediction of interferon-gamma inducing peptides (IFNepitope)237
Prediction of IL4 inducing peptides (IL4pred)334