Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID440579631
StrainMtb_7199-99
Protein IDCCG10034.1
Description putative ALTERNATIVE RNA POLYMERASE SIGMA FACTOR SIGG (RNA POLYMERASE E
Sequence MRTSPMPAKFRSVRVVVITGSVTAAPVRVSETLRRLIDVSVLAENSGREP
ADERRGDFSAHTEPYRRELLAHCYRMTGSLHDAEDLVQETLLRAWKAYEG
FAGKSSLRTWLHRIATNTCLTALEGRRRRPLPTGLGRPSADPSGELVERR
EVSWLEPLPDVTDDPADPSTIVGNRESVRLAFVAALQHLSPRQRAVLLLR
DVLQWKSAEVADAIGTSTVAVNSLLQRARSQLQTVRPSAADRLSAPDSPE
AQDLLARYIAAFEAYDIDRLVELFTAEAIWEMPPYTGWYQGAQAIVTLIH
QQCPAYSPGDMRLISLIANGQPAAAMYMRAGDVHLPFQLHVLDMAADRVS
HVVAFLDTTLFPKFGLPDSL
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)24
MHC class II prediction (Propred)60
MHC class 1 prediction (Propred1)261
CTL epitope prediction (CTLpred)61
Prediction of interferon-gamma inducing peptides (IFNepitope)150
Prediction of IL4 inducing peptides (IL4pred)251