Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID440579649
StrainMtb_7199-99
Protein IDCCG10052.1
Description putative membrane protein [Mycobacterium tuberculosis 7199-99]
Sequence MPDGEQSQPPAQEDAEDDSRPDAAEAAAAEPKSSAGPMFSTYGIASTLLG
VLSVAAVVLGAMIWSAHRDDSGERTYLTRVMLTAAEWTAVLINMNADNID
ASLQRLHDGTVGQLNTDFDAVVQPYRQVVEKLRTHSSGRIEAVAIDTVHR
ELDTQSGAARPVVTTKLPPFATRTDSVLLVATSVSENAGAKPQTVHWNLR
LDVSDVDGKLMISRLESIR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)8
MHC class II prediction (Propred)29
MHC class 1 prediction (Propred1)150
CTL epitope prediction (CTLpred)35
Prediction of interferon-gamma inducing peptides (IFNepitope)53
Prediction of IL4 inducing peptides (IL4pred)126