Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID440579661
StrainMtb_7199-99
Protein IDCCG10064.1
Description putative IRON-REGULATED PHOSPHOENOLPYRUVATE CARBOXYKINASE [GTP] PCKA (P
Sequence MTSATIPGLDTAPTNHQGLLSWVEEVAELTQPDRVVFTDGSEEEFQRLCD
QLVEAGTFIRLNPEKHKNSYLALSDPSDVARVESRTYICSAKEIDAGPTN
NWMDPGEMRSIMKDLYRGCMRGRTMYVVPFCMGPLGAEDPKLGVEITDSE
YVVVSMRTMTRMGKAALEKMGDDGFFVKALHSVGAPLEPGQKDVAWPCSE
TKYITHFPETREIWSYGSGYGGNALLGKKCYSLRIASAMAHDEGWLAEHM
LILKLISPENKAYYFAAAFPSACGKTNLAMLQPTIPGWRAETLGDDIAWM
RFGKDGRLYAVNPEFGFFGVAPGTNWKSNPNAMRTIAAGNTVFTNVALTD
DGDVWWEGLEGDPQHLIDWKGNDWYFRETETNAAHPNSRYCTPMSQCPIL
APEWDDPQGVPISGILFGGRRKTTVPLVTEARDWQHGVFIGATLGSEQTA
AAEGKVGNVRRDPMAMLPFLGYNVGDYFQHWINLGKHADESKLPKVFFVN
WFRRGDDGRFLWPGFGENSRVLKWIVDRIEHKAGGATTPIGTVPAVEDLD
LDGLDVDAADVAAALAVDADEWRQELPLIEEWLQFVGEKLPTGVKDEFDA
LKERLG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)9
Vaccine TargetYes
B cell prediction (LBtope)48
MHC class II prediction (Propred)66
MHC class 1 prediction (Propred1)414
CTL epitope prediction (CTLpred)80
Prediction of interferon-gamma inducing peptides (IFNepitope)233
Prediction of IL4 inducing peptides (IL4pred)433