Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID440580438
StrainMtb_7199-99
Protein IDCCG10841.1
Description putative METAL CATION TRANSPORTER P-TYPE ATPASE CTPV [Mycobacterium tub
Sequence MRVCVTGFNVDAVRAVAIEETVSQVTGVHAVHAYPRTASVVIWYSPELGD
TAAVLSAITKAQHVPAELVPARAPHSAGVRGVGVVRKITGGIRRMLSRPP
GVDKPLKASRCGGRPRGPVRGSASWPGEQNRRERRTWLPRVWLALPLGLL
ALGSSMFFGAYPWAGWLAFAATLPVQFVAGWPILRGAVQQARALTSNMDT
LIALGTLTAFVYSTYQLFAGGPLFFDTSALIIAFVVLGRHLEARATGKAS
EAISKLLELGAKEATLLVDGQELLVPVDQVQVGDLVRVRPGEKIPVDGEV
TDGRAAVDESMLTGESVPVEKTAGDRVAGATVNLDGLLTVRATAVGADTA
LAQIVRLVEQAQGDKAPVQRLADRVSAVFVPAVIGVAVATFAGWTLIAAN
PVAGMTAAVAVLIIACPCALGLATPTAIMVGTGRGAELGILVKGGEVLEA
SKKIDTVVFDKTGTLTRARMRVTDVIAGQRRQPDQVLRLAAAVESGSEHP
IGAAIVAAAHERGLAIPAANAFTAVAGHGVRAQVNGGPVVVGRRKLVDEQ
HLVLPDHLAAAAVEQEERGRTAVFVGQDGQVVGVLAVADTVKDDATDVVG
RLHAMGLQVAMITGDNARTAAAIAKQVGIEKVLAEVLPQDKVAEVRRLQD
QGRVVAMVGDGVNDAPALVQADLGIAIGTGTDVAIEASDITLMSGRLDGV
VRAIELSRQTLRTIYQNLGWAFGYNTAAIPLAALGALNPVVAGAAMGFSS
VSVVTNSLRLRRFGRDGRTA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)52
MHC class II prediction (Propred)129
MHC class 1 prediction (Propred1)541
CTL epitope prediction (CTLpred)133
Prediction of interferon-gamma inducing peptides (IFNepitope)369
Prediction of IL4 inducing peptides (IL4pred)460