Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID440580696
StrainMtb_7199-99
Protein IDCCG11099.1
Description ALTERNATIVE RNA POLYMERASE SIGMA FACTOR SIGE [Mycobacterium tuberculosi
Sequence MELLGGPRVGNTESQLCVADGDDLPTYCSANSEDLNITTITTLSPTSMSH
PQQVRDDQWVEPSDQLQGTAVFDATGDKATMPSWDELVRQHADRVYRLAY
RLSGNQHDAEDLTQETFIRVFRSVQNYQPGTFEGWLHRITTNLFLDMVRR
RARIRMEALPEDYDRVPADEPNPEQIYHDARLGPDLQAALASLPPEFRAA
VVLCDIEGLSYEEIGATLGVKLGTVRSRIHRGRQALRDYLAAHPEHGECA
VHVNPVR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)10
MHC class II prediction (Propred)36
MHC class 1 prediction (Propred1)171
CTL epitope prediction (CTLpred)41
Prediction of interferon-gamma inducing peptides (IFNepitope)110
Prediction of IL4 inducing peptides (IL4pred)156