Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID440581021
StrainMtb_7199-99
Protein IDCCG11424.1
Description putative LIPOprotein SIGNAL PEPTIDASE LSPA [Mycobacterium tuberculosis
Sequence MPDEPTGSADPLTSTEEAGGAGEPNAPAPPRRLRMLLSVAVVVLTLDIVT
KVVAVQLLPPGQPVSIIGDTVTWTLVRNSGAAFSMATGYTWVLTLIATGV
VVGIFWMGRRLVSPWWALGLGMILGGAMGNLVDRFFRAPGPLRGHVVDFL
SVGWWPVFNVADPSVVGGAILLVILSIFGFDFDTVGRRHADGDTVGRRKA
DG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)5
MHC class II prediction (Propred)45
MHC class 1 prediction (Propred1)135
CTL epitope prediction (CTLpred)38
Prediction of interferon-gamma inducing peptides (IFNepitope)60
Prediction of IL4 inducing peptides (IL4pred)108