Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID440581829
StrainMtb_7199-99
Protein IDCCG12232.1
Description putative MEMBRANE-ASSOCIATED PHOSPHOLIPASE C 1 PLCA (MTP40 ANTIGEN) [My
Sequence MSRREFLTKLTGAGAAAFLMDWAAPVIEKAYGAGPCPGHLTDIEHIVLLM
QENRSFDHYFGTLSSTNGFNAASPAFQQMGWNPMTQALDPAGVTIPFRLD
TTRGPFLDGECVNDPEHQWVGMHLAWNGGANDNWLPAQATTRAGPYVPLT
MGYYTRQDIPIHYLLADTFTICDGYHCSLLTGTLPNRLYWLSANIDPAGT
DGGPQLVEPGFLPLQQFSWRIMPENLEDAGVSWKVYQNKGLGRFINTPIS
NNGLVQAFRQAADPRSNLARYGIAPTYPGDFAADVRANRLPKVSWLVPNI
LQSEHPALPVALGAVSMVTALRILLSNPAVWEKTALIVSYDENGGFFDHV
TPPTAPPGTPGEFVTVPNIDAVPGSGGIRGPLGLGFRVPCIVISPYSRGP
LMVSDTFDHTSQLKLIRARFGVPVPNMTAWRDGVVGDMTSAFNFATPPNS
TRPNLSHPLLGALPKLPQCIPNVVLGTTDGALPSIPYRVPYPQVMPTQET
TPVRGTPSGLCS
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)120
MHC class II prediction (Propred)146
MHC class 1 prediction (Propred1)654
CTL epitope prediction (CTLpred)124
Prediction of interferon-gamma inducing peptides (IFNepitope)340
Prediction of IL4 inducing peptides (IL4pred)712