Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID440582420
StrainMtb_7199-99
Protein IDCCG12823.1
Description FATTY-ACID-CoA LIGASE FADD28 (FATTY-ACID-CoA SYNTHETASE) (FATTY-ACID-Co
Sequence MSVRSLPAALRACARLQPHDPAFTFMDYEQDWDGVAITLTWSQLYRRTLN
VAQELSRCGSTGDRVVISAPQGLEYVVAFLGALQAGRIAVPLSVPQGGVT
DERSDSVLSDSSPVAILTTSSAVDDVVQHVARRPGESPPSIIEVDLLDLD
APNGYTFKEDEYPSTAYLQYTSGSTRTPAGVVMSHQNVRVNFEQLMSGYF
ADTDGIPPPNSALVSWLPFYHDMGLVIGICAPILGGYPAVLTSPVSFLQR
PARWMHLMASDFHAFSAAPNFAFELAARRTTDDDMAGRDLGNILTILSGS
ERVQAATIKRFADRFARFNLQERVIRPSYGLAEATVYVATSKPGQPPETV
DFDTESLSAGHAKPCAGGGATSLISYMLPRSPIVRIVDSDTCIECPDGTV
GEIWVHGDNVANGYWQKPDESERTFGGKIVTPSPGTPEGPWLRTGDSGFV
TDGKMFIIGRIKDLLIVYGRNHSPDDIEATIQEITRGRCAAISVPGDRST
EKLVAIIELKKRGDSDQDAMARLGAIKREVTSALSSSHGLSVADLVLVAP
GSIPITTSGKVRRGACVEQYRQDQFARLDA
B cell epitope (IEDB)2
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)37
MHC class II prediction (Propred)91
MHC class 1 prediction (Propred1)381
CTL epitope prediction (CTLpred)78
Prediction of interferon-gamma inducing peptides (IFNepitope)219
Prediction of IL4 inducing peptides (IL4pred)419