Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID440582425
StrainMtb_7199-99
Protein IDCCG12828.1
Description putative CONSERVED LIPOprotein LPPX [Mycobacterium tuberculosis 7199-99
Sequence MNDGKRAVTSAVLVVLGACLALWLSGCSSPKPDAEEQGVPVSPTASDPAL
LAEIRQSLDATKGLTSVHVAVRTTGKVDSLLGITSADVDVRANPLAAKGV
CTYNDEQGVPFRVQGDNISVKLFDDWSNLGSISELSTSRVLDPAAGVTQL
LSGVTNLQAQGTEVIDGISTTKITGTIPASSVKMLDPGAKSARPATVWIA
QDGSHHLVRASIDLGSGSIQLTQSKWNEPVNVD
B cell epitope (IEDB)0
T cell epitope (IEDB)32
MHC binder (IEDB)1
Vaccine TargetYes
B cell prediction (LBtope)20
MHC class II prediction (Propred)24
MHC class 1 prediction (Propred1)142
CTL epitope prediction (CTLpred)22
Prediction of interferon-gamma inducing peptides (IFNepitope)77
Prediction of IL4 inducing peptides (IL4pred)159