Antigen Card |
The is the antigen card for every antigen and all its information available in our database.
gene ID | 440583389 |
Strain | Mtb_7199-99 |
Protein ID | CCG13792.1 |
Description | 6 KDA EARLY SECRETORY ANTIGENIC TARGET ESXA (ESAT-6) [Mycobacterium tub |
Sequence | MTEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQSLTKLAAAWGGSGSEA YQGVQQKWDATATELNNALQNLARTISEAGQAMASTEGNVTGMFA |
B cell epitope (IEDB) | 34 |
T cell epitope (IEDB) | 348 |
MHC binder (IEDB) | 417 |
Vaccine Target | Yes |
B cell prediction (LBtope) | 63 |
MHC class II prediction (Propred) | 14 |
MHC class 1 prediction (Propred1) | 120 |
CTL epitope prediction (CTLpred) | 14 |
Prediction of interferon-gamma inducing peptides (IFNepitope) | 100 |
Prediction of IL4 inducing peptides (IL4pred) | 145 |