Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441213655
StrainM_smegmatis_MKD8
Protein IDZP_20975901.1
Description putative O-methyltransferase [Mycobacterium smegmatis MKD8]
Sequence MLHGLLRAEQDGDAAAFAEVGEFPLDAAPAERAEVLKNVYMSVSQTGGEL
LYLLARATGARTVVEYGTSFGVSTIYLASAVRDNGGGTVITTELQPGKAA
AAQHSFDAAGLGDLIDLRIGDARDTLAQVPRPVDLVLLDGWPDLALPVLE
VLEPHLRAGTLILVDDVNLDFGGRDLHGALLDHLATCGHYRSLTLPIGDG
IEACVRLTDGAKG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo