Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441213702
StrainM_smegmatis_MKD8
Protein IDZP_20975948.1
Description oxoglutarate dehydrogenase (succinyl-transferring)- E1 component [My
Sequence MSSSPSPFGQNEWLVEEMYRKFRDDPSSVDPSWHEFLVDYSPEPTTDSAS
NGRTTTAAPVTPPTPAPAPAPEPKAAPKPAAKTEAKPAKPAKSATPAKGD
ESQILRGAAAAVVKNMNASLEVPTATSVRAIPAKLMIDNRVVINNHLKRT
RGGKISFTHLLGYAIVQAVKKFPNMNRHFAVVDGKPTAITPAHTNLGLAI
DLQGKDGNRSLVVAAIKRCETMRFGQFIAAYEDIVRRARDGKLTAEDFSG
VTISLTNPGTLGTVHSVPRLMQGQGAIIGAGAMEYPAEFQGASEERIADL
GIGKLITLTSTYDHRIIQGAESGDFLRTIHQLLLDDDFFDEIFRELGIPY
EPVRWRTDNPDSIEDKNARVIELIAAYRNRGHLMADIDPLRLDNTRFRSH
PDLDVNSHGLTLWDLDREFKVDGFAGVQRKKLRDILSVLRDAYCRHVGVE
YTHILEPEQQRWIQERVETKHDKPTVAEQKYILSKLNAAEAFETFLQTKY
VGQKRFSLEGAETVIPMMDAVIDQCAEHGLDEVVIAMPHRGRLNVLANIV
GKPYSQIFSEFEGNLNPSQAHGSGDVKYHLGATGTYIQMFGDNDIEVSLT
ANPSHLEAVDPVLEGLVRAKQDLLDTGEEGSDNRFSVVPLMLHGDAAFAG
QGVVAETLNLALLRGYRTGGTIHIVVNNQIGFTTAPTDSRSSEYCTDVAK
MIGAPIFHVNGDDPEACAWVARLAVDFRQAFKKDVVIDMLCYRRRGHNEG
DDPSMTQPYMYDVIDTKRGSRKAYTEALIGRGDISMKEAEDALRDYQGQL
ERVFNEVRELEKHEIEPSESVEADQQIPSKLATAVDKAMLQRIGDAHLAL
PEGFTVHPRVRPVLEKRREMAYEGRIDWAFAELLALGSLIAEGKLVRLSG
QDTQRGTFTQRHAVIVDRKTGEEFTPLQLLATNPDGTPTGGKFLVYNSAL
SEFAAVGFEYGYSVGNPDAMVLWEAQFGDFVNGAQSIIDEFISSGEAKWG
QLSDVVLLLPHGHEGQGPDHTSGRIERFLQLWAEGSMTIAMPSTPANYFH
LLRRHGKDGIQRPLIVFTPKSMLRNNRRQRHPRLHREQVPLGARGADVHR
R
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo