Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441213843
StrainM_smegmatis_MKD8
Protein IDZP_20975975.1
Description putative transcriptional regulatory protein [Mycobacterium smegmatis
Sequence MDDRTAMARIRDTAIEQFGQHGFNVGLRSIAEAAGVSAALVIHHFGSKEG
LRKACDDHVAEVILELKTESMHASDPATWLAYVAEIESYAPLMAYLVRSM
QSGSELAKKFWRRMVDNAEQYLEEGVRTGMLKPSRDPRARARFLAICGGG
GFLLYLQMHDNPTDLRAVLRDYGEDMMLPALEIYSHGLMADTTMYETFLH
QREAGVPFTGTSEEAT
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo