Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441214228
StrainM_smegmatis_MKD8
Protein IDZP_20976052.1
Description signal transduction histidine kinase- LytS [Mycobacterium smegmatis
Sequence MSGEVAIALALALVLTAVVAIVVVRTRRVVATPTERAVHAALHTASSAAR
ALRRGLDTDSAQTAAPYLRGLTVTQGLALFDGDGQLLALDPDDDALWQTD
IVDTCTSTARDSIADQRRKLTSARPMTVVAQPLLTEAGDVLGALVVVTAS
TPGPGMLGAVGEVARYAASQIELAELDASRARLDRAEVLALRAQISPHFI
YNALNTIASFVRTDPDRARELILEFADFTRYSFRAAGQYTTLADELRNID
RYLTLERARFGQSLKVRLQVAPEVLNVVVPFLALQPLVENAVRHGLAGQG
GGTVEIIARDEGTDCVITVEDDGAGMDPETLRAGQGDALADRTDQGAHVG
LTNVDHRLRAAFGNDYGLVVETALGAGTKVMMRVPKFRSGVHAGGGAFG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo