Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441214248
StrainM_smegmatis_MKD8
Protein IDZP_20976072.1
Description NAD-dependent deacetylase [Mycobacterium smegmatis MKD8]
Sequence MPTFRDAETGLWAQVDPYEISSTDGWQRNPEKVWAWYLWRHYMMARVAPN
EAHRAVAAWEDHLDVRVVTQNIDDLHERAGSTNVYHLHGSLFEFRCDACG
SAFEGNLPEMPEPVETIDPPVCPCSGLIRPSVVWFGEPLPDAAWNRSVLA
VSSADVVIVVGTSSIVYPAAGLPEAALAAGKPVIEVNPERTPLSDSATVS
LRETASEALPTLLQRLPELLNRSA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo