Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441214272
StrainM_smegmatis_MKD8
Protein IDZP_20976096.1
Description ptmR1 [Mycobacterium smegmatis MKD8]
Sequence MAGSTPLAPMIGPDAITPRAAVRSPKTAELVAGTLRRMVVEGQLKDGDFL
PNEAELMSHFGVSRPTLREAVRVLESERLVEVRRGSRTGARVRVPGPEIV
ARPAGLLLELSGADIADLLVARSAIEPMAARLLAENGTEEQFAELDRMLE
EHIPSDWQSDRLAETTGDFHRRVVELSGNATLGIIAGMLHEITVRHHQFL
FREHRPVSKSDYDKLMRSYRKLMQIMRSGDGDAAEAHWRTHLDTARALML
QGLESVKVRDVMG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo