Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441214419
StrainM_smegmatis_MKD8
Protein IDZP_20976129.1
Description 3-oxoacyl-[acyl-carrier-protein] reductase [Mycobacterium smegmatis
Sequence MSQRVAIVIGGASGIGWAGAKALAADGCRIVVADRDADAAAARAAELGAP
HTSGHVDVTDEGSVERLFAEVSAAGPIDIVINCAGFSNVGLITDMPAEDF
RSVIDVCLTGGFIVAKHAGRHLPRGGVLVSISSLNARQPAAGMSAYCAAK
AGLSMLTQVAALEMGEAGIRVNAIAPGFVHTPLTAPAAMIPGVVEEYVEN
TALGRAGIPEDIAAAVVFVCSPQASWLTGEVLDLNGGAHLRRYPDVLGHV
MRLAQG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo